Edge Rewrite
// HTMLRewriter · presentation

This page was redesigned at the edge.

Cloudflare fetched the original article and streamed it through HTMLRewriter to apply an entirely new visual system without rebuilding the source page.

Jump to content

Noxiustoxin

From Wikipedia, the free encyclopedia
3D molecular structure of noxiustoxin.

Noxiustoxin (NTX) is a toxin from the venom of the Mexican scorpion Centruroides noxius Hoffmann which block voltage-dependent potassium channels and calcium-activated potassium channels.

Synonyms NTx; NXT; NXT-1; Toxin II.11; Potassium channel toxin alpha-KTx 2.1.[1]
Organism Centruroides noxius Hoffmann (Mexican scorpion)[2]
CAS Number 85205-49-8 (143074-44-6)[3]
Protein Data Bank 1SXM[4]
UniProt ID P08815[5]
Molar Mass 4195.06[1]
Chemical Formula C174H286N52O54S7[3]
Amino Acid Sequence TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN-NH2 (Cys7-Cys29, Cys13-Cys34, Cys17-Cys36)[1]

Sources

[edit]

NTX was first purified from homogenized crude venom extract of the Mexican scorpion Centruroides noxius Hoffmann,[2] found in the Mexican state of Nayarit.[6] NTX accounts for only about 1% of the scorpion venom.[7] NTX is one of the best-studied toxic peptides from scorpion venoms.[6] It was the second purified toxin obtained from the genus Centruroides after neurotoxin II[8] and the first short peptide from scorpion venom to be reported in the literature.[9] The name for noxiustoxin was first proposed in 1982,[2] before which it was known as toxin II-11[9]

Chemistry

[edit]

NTX is a peptide consisting of 39 amino acid residues. It has a molar mass of 4195.06 and the following primary amino acid sequence: TIINVKCTSPKQCSKPCKELYGSSAGAKCMNGKCKCYNN-NH2.[1] The sequence of NTX contains no histidine, arginine, tryptophan, or phenylalanine. NTX has three disulfide bridges[2] (Cys7-Cys29, Cys13-Cys34, Cys17-Cys36) and contains an amidated C-terminus.[10] NTX is similar in sequence to the margatoxin (79% identity), the kaliotoxin (51% identity), the charybdotoxin (49% identity), and the iberiotoxin (38% identity).[10] The three-dimensional solution structure of NTX has been solved by nuclear magnetic resonance (NMR).[11]

Target

[edit]

NTX blocks the pore of several types of voltage-gated K+ channels by reversibly binding to the channel receptor site.[2] Furthermore, it affects calcium-activated potassium channels of skeletal muscles.[12] In the squid axon, NTX was found to have relatively low binding affinity with their target site on the channel protein (KD = 300nM).[9]

Mode of action

[edit]

NTX associates reversibly with K+ channels and thus decreases K+ permeability in brain synaptosomes.[13] The location of the active site of NTX is not completely known yet. However, it is believed to be located close to the N-Terminal portion of the toxin as administration of synthetic-nonapeptide NTX1-9, which corresponds to the N-Terminal sequences of NTX, leads to symptoms of intoxication that are very similar to native NTX, while a second synthetic active fragment, corresponding to the C-Terminal of NTX, did not lead to symptoms of intoxication.[14]

Furthermore, the mode of action of NTX is thought to be concentration dependent. K+ currents are found to be blocked by NTX at concentrations lower than 1.5 μM in a voltage-independent manner and above 1.5 μM in a voltage-dependent manner.[15] The blocking of K+ channels by NTX is never complete, which indicates that NTX is either not able to fully block a channel or that not all channels have a receptor site for NTX.[15]

Toxicity

[edit]

LD50 of the venom is 0.26 μg/g in albino mice after intraperitoneal injection.[16] Intoxication symptoms of mice include hyperexcitability, lacrimation, convulsions, salivation, dyspnea, and eventually death by respiratory paralysis.[14]

Treatment

[edit]

Although the venom of Centruroides noxius Hoffmann is the most toxic of all the Mexican scorpions,[17] it is less medically important, because Centruroides noxius does not cohabitate with humans[18]

Medical significance

[edit]

It is suggested that due to structural similarity between toxins, a vaccine against Centruroides noxius could be efficient against other, more dangerous, Centruroides species that cause more public health problems.[19] 

References

[edit]
  1. 1 2 3 4 "Kalium: Scorpion Toxins Active on Potassium Channels". kaliumdb.org. Retrieved 2017-10-09.
  2. 1 2 3 4 5 Possani, Lourival Domingos; Martin, Brian M.; Svendsen, I. B. (1982-09-01). "The primary structure of noxiustoxin: A K+ channel blocking peptide, purified from the venom of the scorpion Centruroides noxius Hoffmann". Carlsberg Research Communications. 47 (5): 285–289. doi:10.1007/bf02907789. ISSN 0105-1938.
  3. 1 2 "Noxiustoxin | #STN-340 | Alomone labs". www.alomone.com. Retrieved 2017-10-09.
  4. Dauplais, M.; Gilquin, B.; Possani, L. D.; Gurrola-Briones, G.; Roumestand, C.; Menez, A. (1995). "Determination of the three-dimensional solution structure of noxiustoxin: analysis of structural differences with related short-chain scorpion toxins". Biochemistry. 34 (51): 16563–16573. doi:10.2210/pdb1sxm/pdb.
  5. "Potassium channel toxin alpha-KTx 2.1 - Centruroides noxius (Mexican scorpion)". www.uniprot.org. Retrieved 2017-10-09.
  6. 1 2 Possani, Lourival D; Corona, Miguel; Zurita, Mario; Rodrı́guez, Mario H (2002). "From Noxiustoxin to Scorpine and Possible Transgenic Mosquitoes Resistant to Malaria". Archives of Medical Research. 33 (4): 398–404. doi:10.1016/s0188-4409(02)00370-3. PMID 12234530.
  7. Possani, Lourival D; Zurita, Mario; Delepierre, Muriel; Hernández, Fidel H; Rodrguez, Mario H (1998). "From Noxiustoxin to Shiva-3, a peptide toxic to the sporogonic development of Plasmodium berghei". Toxicon. 36 (11): 1683–1692. Bibcode:1998Txcn...36.1683P. doi:10.1016/s0041-0101(98)00161-5. PMID 9792185.
  8. Jover, E.; Couraud, F.; Rochat, H. (1980-08-29). "Two types of scorpion neurotoxins characterized by their binding to two separate receptor sites on rat brain synaptosomes". Biochemical and Biophysical Research Communications. 95 (4): 1607–1614. doi:10.1016/S0006-291X(80)80082-9. ISSN 0006-291X. PMID 7417336.
  9. 1 2 3 Carbone, Emilio; Wanke, Enzo; Prestipino, Gianfranco; Possani, Lourival D.; Maelicke, Alfred (1982-03-04). "Selective blockage of voltage-dependent K+ channels by a novel scorpion toxin". Nature. 296 (5852): 90–91. Bibcode:1982Natur.296...90C. doi:10.1038/296090a0. PMID 6278313. S2CID 32258371.
  10. 1 2 Drakopoulou, E.; Cotton, J.; Virelizier, H.; Bernardi, E.; Schoofs, A.R.; Partiseti, M.; Choquet, D.; Gurrola, G.; Possani, L.D. (1995). "Chemical Synthesis, Structural and Functional Characterization of Noxiustoxin, a Powerful Blocker of Lymphocyte Voltage-Dependent K+ Channels". Biochemical and Biophysical Research Communications. 213 (3): 901–907. doi:10.1006/bbrc.1995.2214. PMID 7654252.
  11. Dauplais, Marc; Gilquin, Bernard; Possani, Lourival D.; Gurrola-Briones, Georgina; Roumestand, Christian; Menez, Andre (1995-12-01). "Determination of the Three-Dimensional Solution Structure of Noxiustoxin: Analysis of Structural Differences with Related Short-Chain Scorpion Toxins". Biochemistry. 34 (51): 16563–16573. doi:10.1021/bi00051a004. ISSN 0006-2960. PMID 8527429.
  12. Valdivia, Hector H.; Smith, Jeffrey S.; Martin, Brian M.; Coronado, Roberto; Possani, Lourival D. (1988-01-04). "Charybdotoxin and noxiustoxin, two homologous peptide inhibitors of the K+(Ca2+) channel". FEBS Letters. 226 (2): 280–284. Bibcode:1988FEBSL.226..280V. doi:10.1016/0014-5793(88)81439-x. ISSN 1873-3468. PMID 2448164.
  13. Sitges, M.; Possani, L. D.; Bayón, A. (June 1986). "Noxiustoxin, a short-chain toxin from the Mexican scorpion Centruroides noxius, induces transmitter release by blocking K+ permeability". The Journal of Neuroscience. 6 (6): 1570–1574. doi:10.1523/JNEUROSCI.06-06-01570.1986. ISSN 0270-6474. PMC 6568734. PMID 3012016.
  14. 1 2 Gurrola, G. B.; Molinar-Rode, R.; Sitges, M.; Bayon, A.; Possani, L. D. (1989). "Synthetic peptides corresponding to the sequence of noxiustoxin indicate that the active site of this K+ channel blocker is located on its amino-terminal portion". Journal of Neural Transmission. 77 (1): 11–20. doi:10.1007/BF01255815. PMID 2746197. S2CID 41665121.
  15. 1 2 Carbone, E.; Prestipino, G.; Spadavecchia, L.; Franciolini, F.; Possani, L. D. (May 1987). "Blocking of the squid axon K+ channel by noxiustoxin: a toxin from the venom of the scorpion Centruroides noxius". Pflügers Archiv: European Journal of Physiology. 408 (5): 423–431. doi:10.1007/BF00585064. ISSN 0031-6768. PMID 2439979. S2CID 20992757.
  16. Possani, Lourival Domingos; Dent, Myrna A. R.; Martin, Brian M.; Maelicke, Alfred; Svendsen, Ib (1981-07-01). "The amino terminal sequence of several toxins from the venom of the Mexican scorpion Centruroides noxius Hoffmann". Carlsberg Research Communications. 46 (4): 207. doi:10.1007/bf02906498. ISSN 0105-1938.
  17. Dent, Myrna A.R.; Possani, Lourival D.; Ramírez, Guillermo A.; Fletcher, Paul L. (1980). "Purification and characterization of two mammalian toxins from the venom of the Mexican scorpion Centruroides noxius Hoffmann". Toxicon. 18 (3): 343–350. Bibcode:1980Txcn...18..343D. doi:10.1016/0041-0101(80)90015-x. PMID 7394823.
  18. Dehesa-Dávila, Manuel; Ramfrez, Angelina N; Zamudio, Fernando Z; Gurrola-Briones, Georgina; Liévano, Arturo; Darszon, Alberto; Possani, Lourival D (1996). "Structural and functional comparison of toxins from the venom of the scorpions Centruroides infamatus infamatus, centruroides limpidus limpidus and Centruroides noxius". Comparative Biochemistry and Physiology Part B: Biochemistry and Molecular Biology. 113 (2): 331–339. doi:10.1016/0305-0491(95)02031-4. PMID 8653586.
  19. Hernández, Ricardo; Gazarian, Tatiana G; Hérion, Pascal S; Gazarian, Karlen G (2002). "Molecular localization and crossreactivity of two epitopes of noxiustoxin from scorpion Centruroides noxius, identified by a panel of monoclonal antibodies and peptide mimotopes". Immunology Letters. 80 (2): 97–103. doi:10.1016/s0165-2478(01)00320-0. PMID 11750040.
[edit]