Edge Rewrite
// request.cf · coarse context

A page that knows where it met you.

Only coarse request metadata is shown. This demo does not display or persist visitor IP addresses.

Country
US
Cloudflare location
CMH
Connection
HTTP/2
Language
Not provided

Ray ID: a2a60326ed622780

Jump to content

Talk:Enaptin

Page contents not supported in other languages.
Add topic
From Wikipedia, the free encyclopedia
Latest comment: 2 years ago by Mr.Sanguine in topic Wiki Education assignment: Biochemistry II

Untitled

[edit]

wow

  • Could anyone explain why the word is so long?
  • It is not a word per se, but rather a chemical code, as with other similiar substances.

Look at the crap!

[edit]

What was with all this:

MATSRGASRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKL- PCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSS- SASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELV- DLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDEILP- GFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRD-

(times eight)

? --User:Alex12_3

  • Are you an idiot? Did you even try reading the article? -- BRIAN0918  03:22, 30 Mar 2005 (UTC)
  • Yeah, I didn't understand it either at first...... then I read the article --Headcase 05:09, 30 Mar 2005 (UTC)

Not the longest

[edit]

It's been brought to my attention that the largest protein in the body is called titin (appropriately), and has 27,000 amino acids. Expect an article soon. -- BRIAN0918  05:28, 30 Mar 2005 (UTC)

  • Alright, it's official: 189,819 letters. -- BRIAN0918  05:43, 30 Mar 2005 (UTC)

Article be cleaned up please

[edit]

Article be cleaned up please secfan 08:31, Mar 30, 2005 (UTC)

Removing that long word...

[edit]

I suggest it be removed... and/or just linked to (or create a new page with this word), as it seems inappropriate in this main article, and people keep removing it not knowing why it was there in the first place. secfan 11:08, Mar 30, 2005 (UTC)

In contrast to Titin, there are little web pages containing the full chemical name of Enaptin. Therefore, I would like to ask everybody for giving reliable web pages about it, except the following web pages:

I provide the preceding web pages for somebody who has curiosity. QQ (talk) 20:34, 17 February 2008 (UTC)Reply

Thanks for the vandalism

[edit]

Thanks for completely vandalizing and tearing to shreds my article overnight. Did any of you even bother to correct the vandalism in the page? No. You were too busy deleting all of its contents to notice the vandalism. -- BRIAN0918  12:58, 30 Mar 2005 (UTC)

How pitiful...

[edit]

Just because the f***ing molecule's name is so long you are having a fight? Come to your senses! --Belgrader 17:59, 30 Mar 2005 (UTC)

Wiki Education assignment: Biochemistry II

[edit]

This article was the subject of a Wiki Education Foundation-supported course assignment, between 16 January 2024 and 1 May 2024. Further details are available on the course page. Student editor(s): Mr.Sanguine (article contribs).

— Assignment last updated by Mr.Sanguine (talk) 13:56, 25 March 2024 (UTC)Reply