Edge Rewrite
// HTMLRewriter · presentation

This page was redesigned at the edge.

Cloudflare fetched the original article and streamed it through HTMLRewriter to apply an entirely new visual system without rebuilding the source page.

// request.cf · coarse context

A page that knows where it met you.

Only coarse request metadata is shown. This demo does not display or persist visitor IP addresses.

Country
US
Cloudflare location
CMH
Connection
HTTP/2
Language
Not provided

Ray ID: a21d76342f96f25b

Jump to content

Altitoxin

From Wikipedia, the free encyclopedia

Altitoxin is a neurotoxin found in the South African scorpion Parabuthus transvaalicus. Injection of altitoxin in mice leads to akinesia, depression and death.[1]

Sources

[edit]
South African spitting scorpion (Parabuthus transvaalicus)

Altitoxin is secreted by the venom gland of the South African spitting (or fattail) scorpion Parabuthus transvaalicus.[1]

Chemistry

[edit]

Altitoxin, with the amino acid sequence ADVPGNYPLDKDGNTYTCLELGENKDCQKVCKLHGVQYGYCYAFFCWCKELDDKDVSV, is 58 amino acid residues long and has a molecular mass of 6598 Da; it has 3 disulfide bridges (Cys18-Cys41, Cys27-Cys46, and Cys31-Cys48).[1] It has large homology to other toxins from the venom of Parabuthus transvaalicus, including bestoxin, birtoxin, ikitoxin and dortoxin.

Target

[edit]

Altitoxin has sequence homology to scorpion β-toxins, suggesting it might target sodium channels. However, its depressing action following injection into mice [1] is not in agreement with the effect of β-toxins on sodium channels. Related scorpion toxins, which include birtoxin and bestoxin, exhibit highly divergent biological activity,[1] indicating that the mode of action of these toxins is highly diverse.

Toxicity

[edit]

An injection of 100 ng altitoxin in 20 g mouse (ED99) causes a state of akinesia and depression. Lethality is reached at injecting 200 ng.[1]

References

[edit]
  1. 1 2 3 4 5 6 Inceoglu, B.; Lango, J.; Pessah, I. N.; Hammock, B. D. (2005). "Three structurally related, highly potent, peptides from the venom of Parabuthus transvaalicus possess divergent biological activity". Toxicon. 45 (6): 727–33. Bibcode:2005Txcn...45..727I. doi:10.1016/j.toxicon.2005.01.020. PMID 15804521.